TMEM93 anticorps (N-Term)

N° du produit ABIN635215

Cet anticorps Lapin Polyclonal détecte spécifiquement TMEM93 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour TMEM93 anticorps (N-Term) (ABIN635215)

Antigène: TMEM93 (Transmembrane Protein 93 (TMEM93))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM93 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMEM93 anticorps

Épitope: N-Term

Specificité: TMEM93 antibody was raised against the N terminal of TMEM93

Purification: Affinity purified

Immunogène: TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM93 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TMEM93 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM93 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM93

Antigène: TMEM93 (Transmembrane Protein 93 (TMEM93))

Autre désignation: TMEM93

Sujet: TMEM93 belongs to the TMEM93 family. It is a multi-pass membrane protein. The function of the TMEM93 protein remains unknown.

Poids moléculaire: 12 kDa (MW of target protein)