PIGQ anticorps (N-Term)

N° du produit ABIN635220

Cet anticorps anti-PIGQ est un anticorps Lapin Polyclonal détectant PIGQ dans WB. Adapté pour Humain.

Aperçu rapide pour PIGQ anticorps (N-Term) (ABIN635220)

Antigène: PIGQ (Phosphatidylinositol Glycan Anchor Biosynthesis, Class Q (PIGQ))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIGQ est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PIGQ anticorps

Épitope: N-Term

Specificité: PIGQ antibody was raised against the N terminal of PIGQ

Purification: Affinity purified

Immunogène: PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIGQ Blocking Peptide, (ABIN5615369), is also available for use as a blocking control in assays to test for specificity of this PIGQ antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGQ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIGQ

Antigène: PIGQ (Phosphatidylinositol Glycan Anchor Biosynthesis, Class Q (PIGQ))

Autre désignation: PIGQ

Sujet: PIGQ is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGQ is a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI).

Poids moléculaire: 65 kDa (MW of target protein)

Pathways: Inositol Metabolic Process