PIGQ anticorps (N-Term)

N° du produit ABIN635220

Détail du produit anti-PIGQ anticorps

Antigène: PIGQ (Phosphatidylinositol Glycan Anchor Biosynthesis, Class Q (PIGQ))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIGQ est non-conjugé

Application: Western Blotting (WB)

Specificité: PIGQ antibody was raised against the N terminal of PIGQ

Purification: Affinity purified

Immunogène: PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIGQ Blocking Peptide, catalog no. 33R-7400, is also available for use as a blocking control in assays to test for specificity of this PIGQ antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGQ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIGQ

Antigène: PIGQ (Phosphatidylinositol Glycan Anchor Biosynthesis, Class Q (PIGQ))

Autre désignation: PIGQ (PIGQ Produits)

Synonymes: anticorps GPI1, anticorps c407A10.1, anticorps Gpi1, anticorps Gpi1h, anticorps Gpi1p, anticorps Gpih, anticorps phosphatidylinositol glycan anchor biosynthesis class Q, anticorps phosphatidylinositol glycan anchor biosynthesis, class Q, anticorps PIGQ, anticorps Pigq

Sujet: PIGQ is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGQ is a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI).

Poids moléculaire: 65 kDa (MW of target protein)

Pathways: Inositol Metabolic Process