TCTN3 anticorps (Middle Region)

N° du produit ABIN635221

Détail du produit anti-TCTN3 anticorps

Antigène: TCTN3 (Tectonic Family Member 3 (TCTN3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TCTN3 est non-conjugé

Application: Western Blotting (WB)

Specificité: TCTN3 antibody was raised against the middle region of TCTN3

Purification: Affinity purified

Immunogène: TCTN3 antibody was raised using the middle region of TCTN3 corresponding to a region with amino acids LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TCTN3 Blocking Peptide, catalog no. 33R-5493, is also available for use as a blocking control in assays to test for specificity of this TCTN3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCTN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TCTN3

Antigène: TCTN3 (Tectonic Family Member 3 (TCTN3))

Autre désignation: TCTN3 (TCTN3 Produits)

Synonymes: anticorps RGD1305166, anticorps C10orf61, anticorps JBTS18, anticorps OFD4, anticorps TECT3, anticorps 4930521E07Rik, anticorps AI197391, anticorps Tect3, anticorps tectonic family member 3, anticorps Tctn3, anticorps TCTN3

Sujet: TCTN3 may be involved in apoptosis regulation.

Poids moléculaire: 64 kDa (MW of target protein)