PEX10 anticorps (Middle Region)
-
- Antigène Voir toutes PEX10 Anticorps
- PEX10 (Peroxisomal Biogenesis Factor 10 (PEX10))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PEX10 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- PEX10 antibody was raised against the middle region of PEX10
- Purification
- Affinity purified
- Immunogène
- PEX10 antibody was raised using the middle region of PEX10 corresponding to a region with amino acids QALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYRLLGVISLLHLVL
- Top Product
- Discover our top product PEX10 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PEX10 Blocking Peptide, catalog no. 33R-7469, is also available for use as a blocking control in assays to test for specificity of this PEX10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PEX10 (Peroxisomal Biogenesis Factor 10 (PEX10))
- Autre désignation
- PEX10 (PEX10 Produits)
- Synonymes
- anticorps ATPEX10, anticorps T9J22.2, anticorps peroxin 10, anticorps NALD, anticorps PBD6A, anticorps PBD6B, anticorps RNF69, anticorps AV128229, anticorps Gm142, anticorps peroxin 10, anticorps peroxisomal biogenesis factor 10, anticorps PEX10, anticorps Pex10
- Sujet
- PEX10 is a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in PEX10 gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome.
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-