PEX10 anticorps (Middle Region)

N° du produit ABIN635224

Cet anticorps Lapin Polyclonal détecte spécifiquement PEX10 dans WB et IHC. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour PEX10 anticorps (Middle Region) (ABIN635224)

Antigène: PEX10 (Peroxisomal Biogenesis Factor 10 (PEX10))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PEX10 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PEX10 anticorps

Épitope: Middle Region

Specificité: PEX10 antibody was raised against the middle region of PEX10

Purification: Affinity purified

Immunogène: PEX10 antibody was raised using the middle region of PEX10 corresponding to a region with amino acids QALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYRLLGVISLLHLVL

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PEX10 Blocking Peptide, (ABIN5615314), is also available for use as a blocking control in assays to test for specificity of this PEX10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PEX10

Antigène: PEX10 (Peroxisomal Biogenesis Factor 10 (PEX10))

Autre désignation: PEX10

Sujet: PEX10 is a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in PEX10 gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process