SLC35D3 anticorps (N-Term)
-
- Antigène Voir toutes SLC35D3 Anticorps
- SLC35D3 (Solute Carrier Family 35, Member D3 (SLC35D3))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC35D3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC35 D3 antibody was raised against the N terminal of SLC35 3
- Purification
- Affinity purified
- Immunogène
- SLC35 D3 antibody was raised using the N terminal of SLC35 3 corresponding to a region with amino acids RYQFSFLTLVQCLTSSTAALSLELLRRLGLIAVPPFGLSLARSFAGVAVL
- Top Product
- Discover our top product SLC35D3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC35D3 Blocking Peptide, catalog no. 33R-8281, is also available for use as a blocking control in assays to test for specificity of this SLC35D3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC35D3 (Solute Carrier Family 35, Member D3 (SLC35D3))
- Autre désignation
- SLC35D3 (SLC35D3 Produits)
- Sujet
- SLC35D3 may play a role in hemostasis as a regulator of the biosynthesis of platelet-dense granules.
- Poids moléculaire
- 44 kDa (MW of target protein)
-