LRRC66 anticorps (Middle Region)

N° du produit ABIN635232

Cet anticorps anti-LRRC66 est un anticorps Lapin Polyclonal détectant LRRC66 dans WB. Adapté pour Humain.

Aperçu rapide pour LRRC66 anticorps (Middle Region) (ABIN635232)

Antigène: LRRC66 (Leucine Rich Repeat Containing 66 (LRRC66))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC66 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LRRC66 anticorps

Épitope: Middle Region

Specificité: LRRC66 antibody was raised against the middle region of LRRC66

Purification: Affinity purified

Immunogène: LRRC66 antibody was raised using the middle region of LRRC66 corresponding to a region with amino acids NVTFQTIPGKCKNQEDPFEKPLISAPDSGMYKTHLENASDTDRSEGLSPW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC66 Blocking Peptide, (ABIN5614586), is also available for use as a blocking control in assays to test for specificity of this LRRC66 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC66 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC66

Antigène: LRRC66 (Leucine Rich Repeat Containing 66 (LRRC66))

Autre désignation: LRRC66

Sujet: The function of LOC339977 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 98 kDa (MW of target protein)