VNN3 anticorps (N-Term)

N° du produit ABIN635233

Détail du produit anti-VNN3 anticorps

Antigène: VNN3 (Vanin 3 (VNN3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VNN3 est non-conjugé

Application: Western Blotting (WB)

Specificité: VNN3 antibody was raised against the N terminal of VNN3

Purification: Affinity purified

Immunogène: VNN3 antibody was raised using the N terminal of VNN3 corresponding to a region with amino acids VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VNN3 Blocking Peptide, catalog no. 33R-9602, is also available for use as a blocking control in assays to test for specificity of this VNN3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VNN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VNN3

Antigène: VNN3 (Vanin 3 (VNN3))

Autre désignation: VNN3 (VNN3 Produits)

Synonymes: anticorps HSA238982, anticorps foap-4, anticorps gpi-80, anticorps hdlcq8, anticorps tiff66, anticorps vnn1.2, anticorps vnn3, anticorps RGD1560609, anticorps VNN3, anticorps vanin 3, anticorps vanin 2, anticorps vascular non-inflammatory molecule 3-like, anticorps vascular non-inflammatory molecule 3, anticorps VNN3, anticorps Vnn3, anticorps vnn2, anticorps LOC708748, anticorps LOC100067649

Sujet: This gene is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. The open reading frame is disrupted by a frameshift, and all splice variants that have been described are candidates for nonsense-mediated decay (NMD). Consequently, it is unlikely that this gene expresses a protein in vivo, so it is classified as a pseudogene. Extensive alternative splicing has been described, the two most common variants are represented as RefSeqs.

Poids moléculaire: 28 kDa (MW of target protein)