C19orf46 anticorps (N-Term)

N° du produit ABIN635247

Cet anticorps anti-C19orf46 est un anticorps Lapin Polyclonal détectant C19orf46 dans WB. Adapté pour Humain.

Aperçu rapide pour C19orf46 anticorps (N-Term) (ABIN635247)

Antigène: C19orf46 (Chromosome 19 Open Reading Frame 46 (C19orf46))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C19orf46 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C19orf46 anticorps

Épitope: N-Term

Specificité: C19 ORF46 antibody was raised against the N terminal Of C19 rf46

Purification: Affinity purified

Immunogène: C19 ORF46 antibody was raised using the N terminal Of C19 rf46 corresponding to a region with amino acids GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C19ORF46 Blocking Peptide, (ABIN938610), is also available for use as a blocking control in assays to test for specificity of this C19ORF46 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C19orf46

Antigène: C19orf46 (Chromosome 19 Open Reading Frame 46 (C19orf46))

Autre désignation: C19ORF46

Sujet: C19orf46 contributes to the establishment of secretory epithelial morphology by promoting kinesin-dependent apical migration of the centrosome and Golgi apparatus and basal localization of the nucleus.

Poids moléculaire: 43 kDa (MW of target protein)