C19orf46 anticorps (N-Term)

N° du produit ABIN635247

Détail du produit anti-C19orf46 anticorps

Antigène: C19orf46 (Chromosome 19 Open Reading Frame 46 (C19orf46))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C19orf46 est non-conjugé

Application: Western Blotting (WB)

Specificité: C19 ORF46 antibody was raised against the N terminal Of C19 rf46

Purification: Affinity purified

Immunogène: C19 ORF46 antibody was raised using the N terminal Of C19 rf46 corresponding to a region with amino acids GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C19ORF46 Blocking Peptide, catalog no. 33R-3224, is also available for use as a blocking control in assays to test for specificity of this C19ORF46 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C19orf46

Antigène: C19orf46 (Chromosome 19 Open Reading Frame 46 (C19orf46))

Autre désignation: C19ORF46 (C19orf46 Produits)

Synonymes: anticorps C19orf46, anticorps Nesp4, anticorps C18H19orf46, anticorps 0610012K07Rik, anticorps AI428936, anticorps RGD1304580, anticorps C1H19orf46, anticorps spectrin repeat containing nuclear envelope family member 4, anticorps spectrin repeat containing, nuclear envelope family member 4, anticorps SYNE4, anticorps Syne4

Sujet: C19orf46 contributes to the establishment of secretory epithelial morphology by promoting kinesin-dependent apical migration of the centrosome and Golgi apparatus and basal localization of the nucleus.

Poids moléculaire: 43 kDa (MW of target protein)