TMEM126B anticorps (N-Term)

N° du produit ABIN635248

Cet anticorps Lapin Polyclonal détecte spécifiquement TMEM126B dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour TMEM126B anticorps (N-Term) (ABIN635248)

Antigène: TMEM126B (Transmembrane Protein 126B (TMEM126B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM126B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMEM126B anticorps

Épitope: N-Term

Specificité: TMEM126 B antibody was raised against the N terminal of TMEM126

Purification: Affinity purified

Immunogène: TMEM126 B antibody was raised using the N terminal of TMEM126 corresponding to a region with amino acids AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM126B Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TMEM126B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM120 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM126B

Antigène: TMEM126B (Transmembrane Protein 126B (TMEM126B))

Autre désignation: TMEM126B

Sujet: TMEM126B belongs to the TMEM126 family. The function remains unknown.

Poids moléculaire: 23 kDa (MW of target protein)