PIEZO2 anticorps (Middle Region)

N° du produit ABIN635249

L’anticorps Lapin Polyclonal anti-PIEZO2 a été validé pour WB. Il convient pour détecter PIEZO2 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PIEZO2 anticorps (Middle Region) (ABIN635249)

Antigène: PIEZO2 (FAM38B) (Family with Sequence Similarity 38, Member B (FAM38B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIEZO2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PIEZO2 anticorps

Épitope: Middle Region

Specificité: FAM38 B antibody was raised against the middle region of FAM38

Purification: Affinity purified

Immunogène: FAM38 B antibody was raised using the middle region of FAM38 corresponding to a region with amino acids AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM38B Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this FAM38B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIEZO2

Antigène: PIEZO2 (FAM38B) (Family with Sequence Similarity 38, Member B (FAM38B))

Autre désignation: FAM38B

Sujet: The exact function of FAM38B remains unknown.

Poids moléculaire: 63 kDa (MW of target protein)