MOGAT1 anticorps (C-Term)

N° du produit ABIN635250

Détail du produit anti-MOGAT1 anticorps

Antigène: MOGAT1 (Monoacylglycerol O-Acyltransferase 1 (MOGAT1))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MOGAT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MOGAT1 antibody was raised against the C terminal of MOGAT1

Purification: Affinity purified

Immunogène: MOGAT1 antibody was raised using the C terminal of MOGAT1 corresponding to a region with amino acids PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MOGAT1 Blocking Peptide, catalog no. 33R-7161, is also available for use as a blocking control in assays to test for specificity of this MOGAT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOGAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MOGAT1

Antigène: MOGAT1 (Monoacylglycerol O-Acyltransferase 1 (MOGAT1))

Autre désignation: MOGAT1 (MOGAT1 Produits)

Synonymes: anticorps DGAT2L, anticorps DGAT2L1, anticorps MGAT1, anticorps 0610030A14Rik, anticorps 1110064N14Rik, anticorps Dgat2l, anticorps Dgat2l1, anticorps mDC2, anticorps mogat2-a, anticorps dgat2l1, anticorps mogat1, anticorps monoacylglycerol O-acyltransferase 1, anticorps 2-acylglycerol O-acyltransferase 1, anticorps monoacylglycerol O-acyltransferase 2, gene 2 L homeolog, anticorps monoacylglycerol O-acyltransferase 1 L homeolog, anticorps MOGAT1, anticorps mogt1, anticorps Mogat1, anticorps Tsp_09229, anticorps mogat2.2.L, anticorps mogat1.L

Sujet: Acyl-CoA:monoacylglycerol acyltransferase (MOGAT, EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids.

Poids moléculaire: 39 kDa (MW of target protein)