Tetraspanin 17 anticorps (N-Term)

N° du produit ABIN635252

L’anticorps anti-Tetraspanin 17 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de Tetraspanin 17 dans des échantillons provenant de Humain, Rat et Souris. }

Aperçu rapide pour Tetraspanin 17 anticorps (N-Term) (ABIN635252)

Antigène: Tetraspanin 17 (TSPAN17)

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tetraspanin 17 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Tetraspanin 17 anticorps

Épitope: N-Term

Specificité: Tetraspanin 17 antibody was raised against the N terminal of TSPAN17

Purification: Affinity purified

Immunogène: Tetraspanin 17 antibody was raised using the N terminal of TSPAN17 corresponding to a region with amino acids GVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tetraspanin 17 Blocking Peptide, (ABIN939033), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 17 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tetraspanin 17

Antigène: Tetraspanin 17 (TSPAN17)

Autre désignation: Tetraspanin 17

Sujet: The function of Tetraspanin 17 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 37 kDa (MW of target protein)