Tetraspanin 17 anticorps (N-Term)

N° du produit ABIN635252

Détail du produit anti-Tetraspanin 17 anticorps

Antigène: Tetraspanin 17 (TSPAN17)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tetraspanin 17 est non-conjugé

Application: Western Blotting (WB)

Specificité: Tetraspanin 17 antibody was raised against the N terminal of TSPAN17

Purification: Affinity purified

Immunogène: Tetraspanin 17 antibody was raised using the N terminal of TSPAN17 corresponding to a region with amino acids GVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tetraspanin 17 Blocking Peptide, catalog no. 33R-3647, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 17 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tetraspanin 17

Antigène: Tetraspanin 17 (TSPAN17)

Autre désignation: Tetraspanin 17 (TSPAN17 Produits)

Synonymes: anticorps fc49c03, anticorps wu:fc49c03, anticorps zgc:158284, anticorps Tspan-17, anticorps fbxo23, anticorps MGC89422, anticorps GB11399, anticorps tetraspanin 17, anticorps FBX23, anticorps FBXO23, anticorps TM4SF17, anticorps 2210021G21Rik, anticorps AI047581, anticorps Fbxo23, anticorps Tm4sf17, anticorps GHB-R, anticorps tetraspanin 17, anticorps tetraspanin 17 S homeolog, anticorps CD63 antigen, anticorps tetraspanin-17 protein, anticorps tspan17, anticorps tspan17.S, anticorps TSPAN17, anticorps LOC552721, anticorps TET17, anticorps Tspan17

Sujet: The function of Tetraspanin 17 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 37 kDa (MW of target protein)