RNF186 anticorps (N-Term)

N° du produit ABIN635255

Détail du produit anti-RNF186 anticorps

Antigène: RNF186 (Ring Finger Protein 186 (RNF186))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF186 est non-conjugé

Application: Western Blotting (WB)

Specificité: RNF186 antibody was raised against the N terminal of RNF186

Purification: Affinity purified

Immunogène: RNF186 antibody was raised using the N terminal of RNF186 corresponding to a region with amino acids MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF186 Blocking Peptide, catalog no. 33R-5617, is also available for use as a blocking control in assays to test for specificity of this RNF186 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF186 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF186

Antigène: RNF186 (Ring Finger Protein 186 (RNF186))

Autre désignation: RNF186 (RNF186 Produits)

Synonymes: anticorps RP11-91K11.1, anticorps 9130020G10Rik, anticorps ring finger protein 186, anticorps RNF186, anticorps Rnf186

Sujet: The specific function of RNF186 is not yet known.

Poids moléculaire: 24 kDa (MW of target protein)