EBP anticorps

N° du produit ABIN635262

Cet anticorps anti-EBP Polyclonal Lapin (ABIN635262) détecte spécifiquement EBP dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour EBP anticorps (ABIN635262)

Antigène: EBP (Emopamil Binding Protein (Sterol Isomerase) (EBP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EBP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EBP anticorps

Purification: Affinity purified

Immunogène: EBP antibody was raised using a synthetic peptide corresponding to a region with amino acids LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EBP Blocking Peptide, (ABIN5613293), is also available for use as a blocking control in assays to test for specificity of this EBP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EBP

Antigène: EBP (Emopamil Binding Protein (Sterol Isomerase) (EBP))

Autre désignation: EBP

Sujet: EBP is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues.

Poids moléculaire: 26 kDa (MW of target protein)