Transferrin Receptor 2 anticorps (Middle Region)

N° du produit ABIN635271

Cet anticorps anti-Transferrin Receptor 2 est un anticorps Polyclonal produit chez le Lapin, détectant Transferrin Receptor 2 dans WB. Convient pour Humain, Souris et Rat.

Aperçu rapide pour Transferrin Receptor 2 anticorps (Middle Region) (ABIN635271)

Antigène: Transferrin Receptor 2 (TFR2)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Transferrin Receptor 2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Transferrin Receptor 2 anticorps

Épitope: Middle Region

Specificité: TFR2 antibody was raised against the middle region of TFR2

Purification: Affinity purified

Immunogène: TFR2 antibody was raised using the middle region of TFR2 corresponding to a region with amino acids YVSLDNAVLGDDKFHAKTSPLLTSLIESVLKQVDSPNHSGQTLYEQVVFT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TFR2 Blocking Peptide, (ABIN936265), is also available for use as a blocking control in assays to test for specificity of this TFR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Transferrin Receptor 2

Antigène: Transferrin Receptor 2 (TFR2)

Autre désignation: TFR2

Sujet: TFR2,a member of the transferrin receptor-like family,is a single-pass type II membrane protein with a protease associated (PA) domain, an M28 peptidase domain and a transferrin receptor-like dimerization domain. This protein mediates cellular uptake of transferrin-bound iron and mutations in this gene have been associated with hereditary hemochromatosis type III.

Poids moléculaire: 89 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis