SGCE anticorps (N-Term)

N° du produit ABIN635274

Détail du produit anti-SGCE anticorps

Antigène: SGCE (Sarcoglycan, epsilon (SGCE))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SGCE est non-conjugé

Application: Western Blotting (WB)

Specificité: SGCE antibody was raised against the N terminal of SGCE

Purification: Affinity purified

Immunogène: SGCE antibody was raised using the N terminal of SGCE corresponding to a region with amino acids TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SGCE Blocking Peptide, catalog no. 33R-9378, is also available for use as a blocking control in assays to test for specificity of this SGCE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGCE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SGCE

Antigène: SGCE (Sarcoglycan, epsilon (SGCE))

Autre désignation: SGCE (SGCE Produits)

Synonymes: anticorps scge, anticorps zgc:92318, anticorps DYT11, anticorps ESG, anticorps e-SG, anticorps sarcoglycan, epsilon, anticorps sarcoglycan epsilon S homeolog, anticorps sarcoglycan epsilon, anticorps sgce, anticorps sgce.S, anticorps SGCE, anticorps Sgce

Sujet: SGCE is a member of the sarcoglycan family. Sarcoglycans are transmembrane components in the dystrophin-glycoprotein complex which help stabilize the muscle fiber membranes and link the muscle cytoskeleton to the extracellular matrix.

Poids moléculaire: 52 kDa (MW of target protein)