IFNGR2 anticorps

N° du produit ABIN635275

Cet anticorps Lapin Polyclonal détecte spécifiquement IFNGR2 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour IFNGR2 anticorps (ABIN635275)

Antigène: IFNGR2 (Interferon gamma Receptor 2 (Interferon gamma Transducer 1) (IFNGR2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFNGR2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IFNGR2 anticorps

Purification: Affinity purified

Immunogène: IFN Gamma R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IFN Gamma R2 Blocking Peptide, (ABIN5614148), is also available for use as a blocking control in assays to test for specificity of this IFN Gamma R2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNGR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IFNGR2

Antigène: IFNGR2 (Interferon gamma Receptor 2 (Interferon gamma Transducer 1) (IFNGR2))

Autre désignation: IFN gamma R2

Sujet: IFNGR2 is the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection.

Poids moléculaire: 35 kDa (MW of target protein)