LRRN2 anticorps (Middle Region)

N° du produit ABIN635276

Détail du produit anti-LRRN2 anticorps

Antigène: LRRN2 (Leucine Rich Repeat Neuronal 2 (LRRN2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRN2 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRN2 antibody was raised against the middle region of LRRN2

Purification: Affinity purified

Immunogène: LRRN2 antibody was raised using the middle region of LRRN2 corresponding to a region with amino acids RVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRN2 Blocking Peptide, catalog no. 33R-8253, is also available for use as a blocking control in assays to test for specificity of this LRRN2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRN2

Antigène: LRRN2 (Leucine Rich Repeat Neuronal 2 (LRRN2))

Autre désignation: LRRN2 (LRRN2 Produits)

Synonymes: anticorps GAC1, anticorps LRRN5, anticorps LRANK1, anticorps FIGLER7, anticorps LRRN2, anticorps leucine rich repeat neuronal 2, anticorps LRRN2, anticorps Lrrn2

Sujet: The protein encoded by this gene belongs to the leucine-rich repeat superfamily. This gene was found to be amplified and overexpressed in malignant gliomas.

Poids moléculaire: 79 kDa (MW of target protein)