ERP29 anticorps (N-Term)

N° du produit ABIN635286

Détail du produit anti-ERP29 anticorps

Antigène: ERP29 (Endoplasmic Reticulum Protein 29 (ERP29))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERP29 est non-conjugé

Application: Western Blotting (WB)

Specificité: ERP29 antibody was raised against the N terminal of ERP29

Purification: Affinity purified

Immunogène: ERP29 antibody was raised using the N terminal of ERP29 corresponding to a region with amino acids MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ERP29 Blocking Peptide, catalog no. 33R-5588, is also available for use as a blocking control in assays to test for specificity of this ERP29 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERP29 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ERP29

Antigène: ERP29 (Endoplasmic Reticulum Protein 29 (ERP29))

Autre désignation: ERP29 (ERP29 Produits)

Synonymes: anticorps C12orf8, anticorps ERp28, anticorps ERp31, anticorps PDI-DB, anticorps PDIA9, anticorps 1200015M03Rik, anticorps 2810446M09Rik, anticorps AW209030, anticorps Erp28, anticorps Erp31, anticorps PDI-Db, anticorps endoplasmic reticulum protein 29, anticorps ERP29, anticorps Erp29

Sujet: This gene encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms.

Poids moléculaire: 26 kDa (MW of target protein)