ABCC11 anticorps

N° du produit ABIN635292

Cet anticorps anti-ABCC11 est un anticorps Lapin Polyclonal détectant ABCC11 dans WB. Adapté pour Humain.

Aperçu rapide pour ABCC11 anticorps (ABIN635292)

Antigène: ABCC11 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11 (ABCC11))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCC11 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ABCC11 anticorps

Purification: Affinity purified

Immunogène: ABCC11 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCC11 Blocking Peptide, (ABIN5611858), is also available for use as a blocking control in assays to test for specificity of this ABCC11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABCC11

Antigène: ABCC11 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11 (ABCC11))

Autre désignation: ABCC11

Sujet: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.

Poids moléculaire: 154 kDa (MW of target protein)