MUC15 anticorps (Middle Region)

N° du produit ABIN635309

L’anticorps anti-MUC15 Polyclonal Lapin est utilisé pour la détection de MUC15 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour MUC15 anticorps (Middle Region) (ABIN635309)

Antigène: MUC15 (Mucin 15, Cell Surface Associated (MUC15))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MUC15 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MUC15 anticorps

Épitope: Middle Region

Specificité: MUC15 antibody was raised against the middle region of MUC15

Purification: Affinity purified

Immunogène: MUC15 antibody was raised using the middle region of MUC15 corresponding to a region with amino acids KFTNNSKLFPNTSDPQKENRNTGIVFGAILGAILGVSLLTLVGYLLCGKR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MUC15 Blocking Peptide, (ABIN939767), is also available for use as a blocking control in assays to test for specificity of this MUC15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MUC15

Antigène: MUC15 (Mucin 15, Cell Surface Associated (MUC15))

Autre désignation: MUC15

Sujet: MUC15 may play a role in the cell adhesion to the extracellular matrix.

Poids moléculaire: 36 kDa (MW of target protein)