PLGRKT anticorps (Middle Region)

N° du produit ABIN635312

L’anticorps anti-PLGRKT Polyclonal Lapin est utilisé pour la détection de PLGRKT dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour PLGRKT anticorps (Middle Region) (ABIN635312)

Antigène: PLGRKT (Plasminogen Receptor, C-Terminal Lysine Transmembrane Protein (PLGRKT))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLGRKT est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PLGRKT anticorps

Épitope: Middle Region

Specificité: C9 ORF46 antibody was raised against the middle region of C9 rf46

Purification: Affinity purified

Immunogène: C9 ORF46 antibody was raised using the middle region of C9 rf46 corresponding to a region with amino acids GTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C9ORF46 Blocking Peptide, (ABIN938997), is also available for use as a blocking control in assays to test for specificity of this C9ORF46 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLGRKT

Antigène: PLGRKT (Plasminogen Receptor, C-Terminal Lysine Transmembrane Protein (PLGRKT))

Autre désignation: C9ORF46

Sujet: The function of C9orf46 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 17 kDa (MW of target protein)