TCTA anticorps (Middle Region)

N° du produit ABIN635313

Cet anticorps anti-TCTA est un anticorps Lapin Polyclonal détectant TCTA dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour TCTA anticorps (Middle Region) (ABIN635313)

Antigène: TCTA (T-Cell Leukemia Translocation Altered (TCTA))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TCTA est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TCTA anticorps

Épitope: Middle Region

Specificité: TCTA antibody was raised against the middle region of TCTA

Purification: Affinity purified

Immunogène: TCTA antibody was raised using the middle region of TCTA corresponding to a region with amino acids IQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TCTA Blocking Peptide, (ABIN939500), is also available for use as a blocking control in assays to test for specificity of this TCTA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCTA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TCTA

Antigène: TCTA (T-Cell Leukemia Translocation Altered (TCTA))

Autre désignation: TCTA

Sujet: A chromosomal aberration, translocation t(1,3)(p34,p21), involving TCTA is associated with T-cell acute lymphoblastic leukemia (T-ALL).

Poids moléculaire: 11 kDa (MW of target protein)