TMEM106C anticorps (Middle Region)
-
- Antigène Tous les produits TMEM106C
- TMEM106C (Transmembrane Protein 106C (TMEM106C))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMEM106C est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMEM106 C antibody was raised against the middle region of TMEM106
- Purification
- Affinity purified
- Immunogène
- TMEM106 C antibody was raised using the middle region of TMEM106 corresponding to a region with amino acids NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMEM106C Blocking Peptide, catalog no. 33R-6694, is also available for use as a blocking control in assays to test for specificity of this TMEM106C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM100 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMEM106C (Transmembrane Protein 106C (TMEM106C))
- Autre désignation
- TMEM106C (TMEM106C Produits)
- Synonymes
- anticorps MGC53571, anticorps tmem106C, anticorps AI046681, anticorps BC046621, anticorps D15Ertd405e, anticorps RGD1311532, anticorps transmembrane protein 106C L homeolog, anticorps transmembrane protein 106C, anticorps tmem106c.L, anticorps TMEM106C, anticorps tmem106c, anticorps Tmem106c
- Sujet
- TMEM106C belongs to the TMEM106 family. The exact function of TMEM106C remains unknown.
- Poids moléculaire
- 28 kDa (MW of target protein)
-