TMEM106C anticorps (Middle Region)

N° du produit ABIN635314

Cet anticorps Lapin Polyclonal détecte spécifiquement TMEM106C dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour TMEM106C anticorps (Middle Region) (ABIN635314)

Antigène: TMEM106C (Transmembrane Protein 106C (TMEM106C))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM106C est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMEM106C anticorps

Épitope: Middle Region

Specificité: TMEM106 C antibody was raised against the middle region of TMEM106

Purification: Affinity purified

Immunogène: TMEM106 C antibody was raised using the middle region of TMEM106 corresponding to a region with amino acids NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM106C Blocking Peptide, (ABIN5616653), is also available for use as a blocking control in assays to test for specificity of this TMEM106C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM100 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM106C

Antigène: TMEM106C (Transmembrane Protein 106C (TMEM106C))

Autre désignation: TMEM106C

Sujet: TMEM106C belongs to the TMEM106 family. The exact function of TMEM106C remains unknown.

Poids moléculaire: 28 kDa (MW of target protein)