ACBD4 anticorps (N-Term)

N° du produit ABIN635315

L’anticorps Lapin Polyclonal anti-ACBD4 a été validé pour WB. Il convient pour détecter ACBD4 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ACBD4 anticorps (N-Term) (ABIN635315)

Antigène: ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACBD4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACBD4 anticorps

Épitope: N-Term

Specificité: ACBD4 antibody was raised against the N terminal of ACBD4

Purification: Affinity purified

Immunogène: ACBD4 antibody was raised using the N terminal of ACBD4 corresponding to a region with amino acids NSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACBD4 Blocking Peptide, (ABIN5611888), is also available for use as a blocking control in assays to test for specificity of this ACBD4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACBD4

Antigène: ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))

Autre désignation: ACBD4

Sujet: ACBD4 is a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism.

Poids moléculaire: 35 kDa (MW of target protein)