C19orf28 anticorps (N-Term)

N° du produit ABIN635321

L’anticorps anti-C19orf28 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de C19orf28 dans des échantillons provenant de Humain. }

Aperçu rapide pour C19orf28 anticorps (N-Term) (ABIN635321)

Antigène: C19orf28 (Chromosome 19 Open Reading Frame 28 (C19orf28))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C19orf28 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C19orf28 anticorps

Épitope: N-Term

Specificité: C19 ORF28 antibody was raised against the N terminal Of C19 rf28

Purification: Affinity purified

Immunogène: C19 ORF28 antibody was raised using the N terminal Of C19 rf28 corresponding to a region with amino acids MGPGPPAAGAAPSPRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C19ORF28 Blocking Peptide, (ABIN5612443), is also available for use as a blocking control in assays to test for specificity of this C19ORF28 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C19orf28

Antigène: C19orf28 (Chromosome 19 Open Reading Frame 28 (C19orf28))

Autre désignation: C19ORF28

Sujet: The C19ORF28 protein may be involved in transmembrane transport.

Poids moléculaire: 59 kDa (MW of target protein)