SLC35E2 anticorps (Middle Region)

N° du produit ABIN635327

Détail du produit anti-SLC35E2 anticorps

Antigène: SLC35E2 (Solute Carrier Family 35, Member E2 (SLC35E2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC35E2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC35 E2 antibody was raised against the middle region of SLC35 2

Purification: Affinity purified

Immunogène: SLC35 E2 antibody was raised using the middle region of SLC35 2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC35E2 Blocking Peptide, catalog no. 33R-1007, is also available for use as a blocking control in assays to test for specificity of this SLC35E2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC35E2

Antigène: SLC35E2 (Solute Carrier Family 35, Member E2 (SLC35E2))

Autre désignation: SLC35E2 (SLC35E2 Produits)

Synonymes: anticorps Slc35e2, anticorps SLC35E2, anticorps A530082C11Rik, anticorps AI957035, anticorps solute carrier family 35, member E2B, anticorps solute carrier family 35 member E2B, anticorps solute carrier family 35 member E3, anticorps solute carrier family 35 member E2, anticorps solute carrier family 35, member E2, anticorps Slc35e2b, anticorps SLC35E2B, anticorps SLC35E3, anticorps SLC35E2, anticorps Slc35e2

Sujet: SLC35E2 is a putative transporter.

Poids moléculaire: 29 kDa (MW of target protein)