Lamin B Receptor anticorps (Middle Region)

N° du produit ABIN635330

L’anticorps Lapin Polyclonal anti-Lamin B Receptor a été validé pour WB. Il convient pour détecter Lamin B Receptor dans des échantillons de Humain.

Aperçu rapide pour Lamin B Receptor anticorps (Middle Region) (ABIN635330)

Antigène: Lamin B Receptor (LBR)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Lamin B Receptor est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Lamin B Receptor anticorps

Épitope: Middle Region

Specificité: Lamin B Receptor antibody was raised against the middle region of LBR

Purification: Affinity purified

Immunogène: Lamin B Receptor antibody was raised using the middle region of LBR corresponding to a region with amino acids GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Lamin B Receptor Blocking Peptide, (ABIN938550), is also available for use as a blocking control in assays to test for specificity of this Lamin B Receptor antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LBR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Lamin B Receptor

Antigène: Lamin B Receptor (LBR)

Autre désignation: Lamin B Receptor

Sujet: The protein encoded by this gene belongs to the ERG4/ERG24 family. It is localized in the nuclear envelope inner membrane and anchors the lamina and the heterochromatin to the membrane. It may mediate interaction between chromatin and lamin B. Mutations of this gene has been associated with autosomal recessive HEM/Greenberg skeletal dysplasia. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Poids moléculaire: 71 kDa (MW of target protein)