TM4SF20 anticorps (Middle Region)

N° du produit ABIN635333

L’anticorps Lapin Polyclonal anti-TM4SF20 a été validé pour WB. Il convient pour détecter TM4SF20 dans des échantillons de Humain.

Aperçu rapide pour TM4SF20 anticorps (Middle Region) (ABIN635333)

Antigène: TM4SF20 (Transmembrane 4 L Six Family Member 20 (TM4SF20))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TM4SF20 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TM4SF20 anticorps

Épitope: Middle Region

Specificité: TM4 SF20 antibody was raised against the middle region of TM4 F20

Purification: Affinity purified

Immunogène: TM4 SF20 antibody was raised using the middle region of TM4 F20 corresponding to a region with amino acids QALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TM4SF20 Blocking Peptide, (ABIN5616644), is also available for use as a blocking control in assays to test for specificity of this TM4SF20 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TM4SF20

Antigène: TM4SF20 (Transmembrane 4 L Six Family Member 20 (TM4SF20))

Autre désignation: TM4SF20

Sujet: TM4SF20 functions as a cellular component of the plasma membrane.

Poids moléculaire: 25 kDa (MW of target protein)