SLC33A1 anticorps

N° du produit ABIN635371

Cet anticorps Lapin Polyclonal détecte spécifiquement SLC33A1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour SLC33A1 anticorps (ABIN635371)

Antigène: SLC33A1 (Solute Carrier Family 33 Member 1 (SLC33A1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC33A1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC33A1 anticorps

Purification: Affinity purified

Immunogène: SLC33 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC33A1 Blocking Peptide, (ABIN937143), is also available for use as a blocking control in assays to test for specificity of this SLC33A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC33A1

Antigène: SLC33A1 (Solute Carrier Family 33 Member 1 (SLC33A1))

Autre désignation: SLC33A1

Sujet: SLC33A1 is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.

Poids moléculaire: 61 kDa (MW of target protein)