SLC33A1 anticorps

N° du produit ABIN635371

Détail du produit anti-SLC33A1 anticorps

Antigène: SLC33A1 (Solute Carrier Family 33 Member 1 (SLC33A1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC33A1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC33 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC33A1 Blocking Peptide, catalog no. 33R-1757, is also available for use as a blocking control in assays to test for specificity of this SLC33A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC33A1

Antigène: SLC33A1 (Solute Carrier Family 33 Member 1 (SLC33A1))

Autre désignation: SLC33A1 (SLC33A1 Produits)

Synonymes: anticorps zgc:63693, anticorps ACATN, anticorps AT-1, anticorps AT1, anticorps CCHLND, anticorps SPG42, anticorps AI315656, anticorps AI788741, anticorps Acatn, anticorps D630022N01Rik, anticorps solute carrier family 33 (acetyl-CoA transporter), member 1, anticorps solute carrier family 33 member 1, anticorps slc33a1, anticorps SLC33A1, anticorps Slc33a1

Sujet: SLC33A1 is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.

Poids moléculaire: 61 kDa (MW of target protein)