Slc38a5 anticorps (N-Term)
-
- Antigène Voir toutes Slc38a5 Anticorps
- Slc38a5 (Solute Carrier Family 38, Member 5 (Slc38a5))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Slc38a5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC38 A5 antibody was raised against the N terminal of SLC38 5
- Purification
- Affinity purified
- Immunogène
- SLC38 A5 antibody was raised using the N terminal of SLC38 5 corresponding to a region with amino acids GIRAYEQLGQRAFGPAGKVVVATVICLHNVGAMSSYLFIIKSELPLVIGT
- Top Product
- Discover our top product Slc38a5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC38A5 Blocking Peptide, catalog no. 33R-3343, is also available for use as a blocking control in assays to test for specificity of this SLC38A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Slc38a5 (Solute Carrier Family 38, Member 5 (Slc38a5))
- Autre désignation
- SLC38A5 (Slc38a5 Produits)
- Synonymes
- anticorps MGC80848, anticorps slc38a3, anticorps SN2, anticorps JM24, anticorps SNAT5, anticorps pp7194, anticorps C81234, anticorps E330031E14, anticorps solute carrier family 38 member 5 S homeolog, anticorps solute carrier family 38 member 5, anticorps solute carrier family 38, member 5, anticorps slc38a5.S, anticorps SLC38A5, anticorps slc38a5, anticorps Slc38a5
- Sujet
- The protein encoded by this gene is a system N sodium-coupled amino acid transporter involved in the transfer of glutamine, asparagine, histidine, serine, alanine, and glycine.
- Poids moléculaire
- 51 kDa (MW of target protein)
-