SLC35F3 anticorps (Middle Region)

N° du produit ABIN635380

Cet anticorps Lapin Polyclonal détecte spécifiquement SLC35F3 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour SLC35F3 anticorps (Middle Region) (ABIN635380)

Antigène: SLC35F3 (Solute Carrier Family 35, Member F3 (SLC35F3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC35F3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC35F3 anticorps

Épitope: Middle Region

Specificité: SLC35 F3 antibody was raised against the middle region of SLC35 3

Purification: Affinity purified

Immunogène: SLC35 F3 antibody was raised using the middle region of SLC35 3 corresponding to a region with amino acids LKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC35F3 Blocking Peptide, (ABIN940497), is also available for use as a blocking control in assays to test for specificity of this SLC35F3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC35F3

Antigène: SLC35F3 (Solute Carrier Family 35, Member F3 (SLC35F3))

Autre désignation: SLC35F3

Sujet: SLC35F3 is a multi-pass membrane proteinPotential. It belongs to the SLC35F solute transporter family. SLC35F3 is a putative solute transporter.

Poids moléculaire: 55 kDa (MW of target protein)