TMEM200B anticorps (N-Term)

N° du produit ABIN635385

Détail du produit anti-TMEM200B anticorps

Antigène: TMEM200B (Transmembrane Protein 200B (TMEM200B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM200B est non-conjugé

Application: Western Blotting (WB)

Specificité: TTMB antibody was raised against the N terminal Of Ttmb

Purification: Affinity purified

Immunogène: TTMB antibody was raised using the N terminal Of Ttmb corresponding to a region with amino acids AGYWPHRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPVI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TTMB Blocking Peptide, catalog no. 33R-1238, is also available for use as a blocking control in assays to test for specificity of this TTMB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTMB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM200B

Antigène: TMEM200B (Transmembrane Protein 200B (TMEM200B))

Autre désignation: TTMB (TMEM200B Produits)

Synonymes: anticorps TTMB, anticorps EG623230, anticorps transmembrane protein 200B, anticorps TMEM200B, anticorps Tmem200b

Sujet: TTMB is a multi-pass membrane protein. It belongs to the TMEM200 family. The function of the TTMB protein remains unknown.

Poids moléculaire: 33 kDa (MW of target protein)