GP2 anticorps

N° du produit ABIN635391

Détail du produit anti-GP2 anticorps

Antigène: GP2 (Glycoprotein 2 (Zymogen Granule Membrane) (GP2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GP2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Glycoprotein 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Glycoprotein 2 Blocking Peptide, catalog no. 33R-8616, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GP2

Antigène: GP2 (Glycoprotein 2 (Zymogen Granule Membrane) (GP2))

Autre désignation: Glycoprotein 2 (GP2 Produits)

Synonymes: anticorps ZAP75, anticorps 2310037I18Rik, anticorps AV060639, anticorps gp80, anticorps glycoprotein 2, anticorps glycoprotein 2 (zymogen granule membrane), anticorps GP2, anticorps Gp2

Classe de substances: Viral Protein

Sujet: GP2 is component of pancreatic secretory (zymogen) granule. The exact function of GP2 remains unknown.

Poids moléculaire: 43 kDa (MW of target protein)