C20orf30 anticorps (C-Term)

N° du produit ABIN635395

Détail du produit anti-C20orf30 anticorps

Antigène: C20orf30 (Chromosome 20 Open Reading Frame 30 (C20orf30))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C20orf30 est non-conjugé

Application: Western Blotting (WB)

Specificité: C20 ORF30 antibody was raised against the C terminal Of C20 rf30

Purification: Affinity purified

Immunogène: C20 ORF30 antibody was raised using the C terminal Of C20 rf30 corresponding to a region with amino acids KGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C20ORF30 Blocking Peptide, catalog no. 33R-4391, is also available for use as a blocking control in assays to test for specificity of this C20ORF30 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C20orf30

Antigène: C20orf30 (Chromosome 20 Open Reading Frame 30 (C20orf30))

Autre désignation: C20ORF30 (C20orf30 Produits)

Synonymes: anticorps MGC89669, anticorps C20orf30, anticorps TMEM230, anticorps c20orf30, anticorps HSPC274, anticorps dJ1116H23.2.1, anticorps C13H20orf30, anticorps RGD1307399, anticorps 5730494N06Rik, anticorps AA407821, anticorps transmembrane protein 230, anticorps transmembrane protein 230 L homeolog, anticorps tmem230, anticorps TMEM230, anticorps tmem230.L, anticorps Tmem230

Sujet: The function of C20orf30 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 13 kDa (MW of target protein)