FAM171A1 anticorps (Middle Region)

N° du produit ABIN635396

Détail du produit anti-FAM171A1 anticorps

Antigène: FAM171A1 (C10ORF38) (Chromosome 10 Open Reading Frame 38 (C10ORF38))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM171A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: C10 ORF38 antibody was raised against the middle region of C10 rf38

Purification: Affinity purified

Immunogène: C10 ORF38 antibody was raised using the middle region of C10 rf38 corresponding to a region with amino acids ARKSMEREGYESSGNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C10ORF38 Blocking Peptide, catalog no. 33R-1479, is also available for use as a blocking control in assays to test for specificity of this C10ORF38 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM171A1

Antigène: FAM171A1 (C10ORF38) (Chromosome 10 Open Reading Frame 38 (C10ORF38))

Autre désignation: C10ORF38 (C10ORF38 Produits)

Synonymes: anticorps C10orf38, anticorps family with sequence similarity 171 member A1, anticorps family with sequence similarity 171, member A1, anticorps FAM171A1

Sujet: C10orf38 is probably involved in oxidoreductase activity.

Poids moléculaire: 98 kDa (MW of target protein)