HS3ST3B1 anticorps

N° du produit ABIN635433

Cet anticorps anti-HS3ST3B1 est un anticorps Lapin Polyclonal détectant HS3ST3B1 dans WB. Adapté pour Humain.

Aperçu rapide pour HS3ST3B1 anticorps (ABIN635433)

Antigène: HS3ST3B1 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HS3ST3B1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HS3ST3B1 anticorps

Purification: Affinity purified

Immunogène: HS3 ST3 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HS3ST3B1 Blocking Peptide, (ABIN936773), is also available for use as a blocking control in assays to test for specificity of this HS3ST3B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HS3ST3B1

Antigène: HS3ST3B1 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1))

Autre désignation: HS3ST3B1

Sujet: HS3ST3B1 is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, and these two enzymes sulfate an identical disaccharide.

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process