HS3ST3B1 anticorps

N° du produit ABIN635433

Détail du produit anti-HS3ST3B1 anticorps

Antigène: HS3ST3B1 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HS3ST3B1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: HS3 ST3 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HS3ST3B1 Blocking Peptide, catalog no. 33R-1387, is also available for use as a blocking control in assays to test for specificity of this HS3ST3B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HS3ST3B1

Antigène: HS3ST3B1 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1))

Autre désignation: HS3ST3B1 (HS3ST3B1 Produits)

Synonymes: anticorps 30ST3B1, anticorps 3OST3B1, anticorps 3-OST-3B, anticorps 3Ost3b, anticorps AU041882, anticorps AW536289, anticorps Hs3st3b, anticorps m3-OST-3B, anticorps zgc:152967, anticorps HS3ST3B1, anticorps heparan sulfate-glucosamine 3-sulfotransferase 3B1, anticorps heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1, anticorps heparan sulfate glucosamine 3-O-sulfotransferase 3B1, anticorps heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1b, anticorps heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1a, anticorps heparan sulfate glucosamine 3-O-sulfotransferase 3B1-like, anticorps HS3ST3B1, anticorps Hs3st3b1, anticorps LOC489516, anticorps hs3st3b1b, anticorps hs3st3b1a, anticorps HS3ST3B1L

Sujet: HS3ST3B1 is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, and these two enzymes sulfate an identical disaccharide.

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process