SYNGR4 anticorps (N-Term)

N° du produit ABIN635439

Détail du produit anti-SYNGR4 anticorps

Antigène: SYNGR4 (Synaptogyrin 4 (SYNGR4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SYNGR4 est non-conjugé

Application: Western Blotting (WB)

Specificité: Synaptogyrin 4 antibody was raised against the N terminal of SYNGR4

Purification: Affinity purified

Immunogène: Synaptogyrin 4 antibody was raised using the N terminal of SYNGR4 corresponding to a region with amino acids MHIPKSLQELANSEAVQFLRRPKTITRVFEGVFSLIVFSSLLTDGYQNKM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Synaptogyrin 4 Blocking Peptide, catalog no. 33R-6093, is also available for use as a blocking control in assays to test for specificity of this Synaptogyrin 4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNGR4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SYNGR4

Antigène: SYNGR4 (Synaptogyrin 4 (SYNGR4))

Autre désignation: Synaptogyrin 4 (SYNGR4 Produits)

Synonymes: anticorps 1700016O14Rik, anticorps synaptogyrin 4, anticorps SYNGR4, anticorps Syngr4

Sujet: SYNGR4 is an integral membrane protein. The gene belongs to the synaptogyrin gene family. Like other members of the family the protein contains four transmembrane regions. The exact function of this protein is unclear.

Poids moléculaire: 26 kDa (MW of target protein)