Ferric-Chelate Reductase 1 Like (FRRS1L) (Middle Region) anticorps

N° du produit ABIN635441

Détail du produit

Antigène: Ferric-Chelate Reductase 1 Like (FRRS1L)

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: C9 ORF4 antibody was raised against the middle region of C9 rf4

Purification: Affinity purified

Immunogène: C9 ORF4 antibody was raised using the middle region of C9 rf4 corresponding to a region with amino acids HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C9ORF4 Blocking Peptide, catalog no. 33R-3707, is also available for use as a blocking control in assays to test for specificity of this C9ORF4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Ferric-Chelate Reductase 1 Like (FRRS1L)

Autre désignation: C9ORF4 (FRRS1L Produits)

Synonymes: anticorps C9orf4, anticorps CG-6, anticorps CG6, anticorps 6430704M03Rik, anticorps ferric chelate reductase 1 like, anticorps ferric-chelate reductase 1 like, anticorps FRRS1L, anticorps Frrs1l

Sujet: The function of C9orf4 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 37 kDa (MW of target protein)