RHBDL2 anticorps

N° du produit ABIN635453

L’anticorps anti-RHBDL2 Polyclonal Lapin est utilisé pour la détection de RHBDL2 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour RHBDL2 anticorps (ABIN635453)

Antigène: RHBDL2 (Rhomboid, Veinlet-Like 2 (RHBDL2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHBDL2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RHBDL2 anticorps

Purification: Affinity purified

Immunogène: RHBDL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RHBDL2 Blocking Peptide, (ABIN940118), is also available for use as a blocking control in assays to test for specificity of this RHBDL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHBDL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RHBDL2

Antigène: RHBDL2 (Rhomboid, Veinlet-Like 2 (RHBDL2))

Autre désignation: RHBDL2

Sujet: RHBDL2 is a member of the rhomboid family of integral membrane proteins. This family contains proteins that are related to Drosophila rhomboid protein. Members of this family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases. RHBDL2 is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3.

Poids moléculaire: 34 kDa (MW of target protein)