TMEM127 anticorps (Middle Region)

N° du produit ABIN635454

Cet anticorps anti-TMEM127 est un anticorps Lapin Polyclonal détectant TMEM127 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour TMEM127 anticorps (Middle Region) (ABIN635454)

Antigène: TMEM127 (Transmembrane Protein 127 (TMEM127))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM127 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMEM127 anticorps

Épitope: Middle Region

Specificité: TMEM127 antibody was raised against the middle region of TMEM127

Purification: Affinity purified

Immunogène: TMEM127 antibody was raised using the middle region of TMEM127 corresponding to a region with amino acids AFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM127 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TMEM127 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM127 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM127

Antigène: TMEM127 (Transmembrane Protein 127 (TMEM127))

Autre désignation: TMEM127

Sujet: TMEM127 is a multi-pass membrane protein. The exact function of TMEM127 remains unknown.

Poids moléculaire: 26 kDa (MW of target protein)