HLC8 anticorps (N-Term)

N° du produit ABIN635456

L’anticorps Lapin Polyclonal anti-HLC8 a été validé pour WB. Il convient pour détecter HLC8 dans des échantillons de Humain.

Aperçu rapide pour HLC8 anticorps (N-Term) (ABIN635456)

Antigène: HLC8 (C17orf80) (Chromosome 17 Open Reading Frame 80 (C17orf80))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HLC8 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HLC8 anticorps

Épitope: N-Term

Specificité: C17 ORF80 antibody was raised against the N terminal Of C17 rf80

Purification: Affinity purified

Immunogène: C17 ORF80 antibody was raised using the N terminal Of C17 rf80 corresponding to a region with amino acids MSDNPPRMEVCPYCKKPFKRLKSHLPYCKMIGPTIPTDQKVYQSKPATLP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C17ORF80 Blocking Peptide, (ABIN5612429), is also available for use as a blocking control in assays to test for specificity of this C17ORF80 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HLC8

Antigène: HLC8 (C17orf80) (Chromosome 17 Open Reading Frame 80 (C17orf80))

Autre désignation: C17ORF80

Sujet: The function of C17orf80 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 67 kDa (MW of target protein)