C7orf42 anticorps (N-Term)

N° du produit ABIN635459

L’anticorps Lapin Polyclonal anti-C7orf42 a été validé pour WB. Il convient pour détecter C7orf42 dans des échantillons de Humain.

Aperçu rapide pour C7orf42 anticorps (N-Term) (ABIN635459)

Antigène: C7orf42 (Chromosome 7 Open Reading Frame 42 (C7orf42))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C7orf42 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C7orf42 anticorps

Épitope: N-Term

Specificité: C7 ORF42 antibody was raised against the N terminal Of C7 rf42

Purification: Affinity purified

Immunogène: C7 ORF42 antibody was raised using the N terminal Of C7 rf42 corresponding to a region with amino acids FSINPLENLKVYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C7ORF42 Blocking Peptide, (ABIN938451), is also available for use as a blocking control in assays to test for specificity of this C7ORF42 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C7orf42

Antigène: C7orf42 (Chromosome 7 Open Reading Frame 42 (C7orf42))

Autre désignation: C7ORF42

Sujet: The function of C7orf42 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 35 kDa (MW of target protein)