TEX2 anticorps (N-Term)

N° du produit ABIN635462

Détail du produit anti-TEX2 anticorps

Antigène: TEX2 (Testis Expressed 2 (TEX2))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TEX2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TEX2 antibody was raised against the N terminal of TEX2

Purification: Affinity purified

Immunogène: TEX2 antibody was raised using the N terminal of TEX2 corresponding to a region with amino acids KSLSTEVEPKESPHPARHRHLMKTLVKSLSTDTSRQESDTVSYKPPDSKL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TEX2 Blocking Peptide, catalog no. 33R-4657, is also available for use as a blocking control in assays to test for specificity of this TEX2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEX2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TEX2

Antigène: TEX2 (Testis Expressed 2 (TEX2))

Autre désignation: TEX2 (TEX2 Produits)

Synonymes: anticorps HT008, anticorps TMEM96, anticorps 4930568E07Rik, anticorps AI553404, anticorps Def-5, anticorps Taz4, anticorps testis expressed 2, anticorps testis expressed gene 2, anticorps TEX2, anticorps Tex2

Sujet: TEX2 is a multi-pass membrane protein. The exact function of TEX2 remains unknown.

Poids moléculaire: 126 kDa (MW of target protein)