TMCO1 anticorps (C-Term)

N° du produit ABIN635466

Cet anticorps anti-TMCO1 est un anticorps Lapin Polyclonal détectant TMCO1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour TMCO1 anticorps (C-Term) (ABIN635466)

Antigène: TMCO1 (Transmembrane and Coiled-Coil Domains 1 (TMCO1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMCO1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMCO1 anticorps

Épitope: C-Term

Specificité: TMCO1 antibody was raised against the C terminal of TMCO1

Purification: Affinity purified

Immunogène: TMCO1 antibody was raised using the C terminal of TMCO1 corresponding to a region with amino acids CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMCO1 Blocking Peptide, (ABIN937193), is also available for use as a blocking control in assays to test for specificity of this TMCO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMCO1

Antigène: TMCO1 (Transmembrane and Coiled-Coil Domains 1 (TMCO1))

Autre désignation: TMCO1

Sujet: TMCO1 belongs to the TMCO1 family. The exact function of TMCO1 remains unknown.

Poids moléculaire: 21 kDa (MW of target protein)